CHAC2 antibody
-
- Target See all CHAC2 Antibodies
- CHAC2 (ChaC, Cation Transport Regulator Homolog 2 (CHAC2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHAC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CHAC2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV
- Top Product
- Discover our top product CHAC2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHAC2 Blocking Peptide, catalog no. 33R-6622, is also available for use as a blocking control in assays to test for specificity of this CHAC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHAC2 (ChaC, Cation Transport Regulator Homolog 2 (CHAC2))
- Alternative Name
- CHAC2 (CHAC2 Products)
- Synonyms
- 2510006C20Rik antibody, chac antibody, fj84c08 antibody, im:7150709 antibody, wu:fj84c08 antibody, zgc:110055 antibody, RGD1309120 antibody, ChaC cation transport regulator homolog 2 antibody, ChaC, cation transport regulator homolog 2 antibody, ChaC, cation transport regulator 2 antibody, ChaC, cation transport regulator homolog 2 S homeolog antibody, ChaC, cation transport regulator homolog 2 (E. coli) antibody, ChaC cation transport regulator 2 antibody, CHAC2 antibody, chac2 antibody, Chac2 antibody, chac2.S antibody
- Background
- The function of CHAC protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 21 kDa (MW of target protein)
-