OLAH antibody (N-Term)
-
- Target See all OLAH products
- OLAH (Oleoyl-ACP Hydrolase (OLAH))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OLAH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OLAH antibody was raised against the N terminal of OLAH
- Purification
- Affinity purified
- Immunogen
- OLAH antibody was raised using the N terminal of OLAH corresponding to a region with amino acids MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OLAH Blocking Peptide, catalog no. 33R-6029, is also available for use as a blocking control in assays to test for specificity of this OLAH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLAH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OLAH (Oleoyl-ACP Hydrolase (OLAH))
- Alternative Name
- OLAH (OLAH Products)
- Synonyms
- thedc1 antibody, THEDC1 antibody, AURA1 antibody, SAST antibody, AI607300 antibody, E230009B14Rik antibody, Thedc1 antibody, Mch antibody, oleoyl-ACP hydrolase antibody, S-acyl fatty acid synthase thioesterase, medium chain antibody, olah antibody, OLAH antibody, LOC100349940 antibody, Olah antibody
- Background
- OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex.
- Molecular Weight
- 30 kDa (MW of target protein)
-