OLAH antibody (N-Term)

Catalog No. ABIN632883

Product Details anti-OLAH Antibody

Target: OLAH (Oleoyl-ACP Hydrolase (OLAH))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OLAH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OLAH antibody was raised against the N terminal of OLAH

Purification: Affinity purified

Immunogen: OLAH antibody was raised using the N terminal of OLAH corresponding to a region with amino acids MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OLAH Blocking Peptide, catalog no. 33R-6029, is also available for use as a blocking control in assays to test for specificity of this OLAH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLAH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OLAH

Target: OLAH (Oleoyl-ACP Hydrolase (OLAH))

Alternative Name: OLAH (OLAH Products)

Synonyms: thedc1 antibody, THEDC1 antibody, AURA1 antibody, SAST antibody, AI607300 antibody, E230009B14Rik antibody, Thedc1 antibody, Mch antibody, oleoyl-ACP hydrolase antibody, S-acyl fatty acid synthase thioesterase, medium chain antibody, olah antibody, OLAH antibody, LOC100349940 antibody, Olah antibody

Background: OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex.

Molecular Weight: 30 kDa (MW of target protein)