PSPH antibody (Middle Region)
-
- Target See all PSPH Antibodies
- PSPH (Phosphoserine Phosphatase (PSPH))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PSPH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PSPH antibody was raised against the middle region of PSPH
- Purification
- Affinity purified
- Immunogen
- PSPH antibody was raised using the middle region of PSPH corresponding to a region with amino acids IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE
- Top Product
- Discover our top product PSPH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PSPH Blocking Peptide, catalog no. 33R-4067, is also available for use as a blocking control in assays to test for specificity of this PSPH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSPH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSPH (Phosphoserine Phosphatase (PSPH))
- Alternative Name
- PSPH (PSPH Products)
- Synonyms
- PSP antibody, PSPHD antibody, AI480570 antibody, PSPase antibody, PSPH antibody, psph antibody, MGC78828 antibody, zgc:112414 antibody, DDBDRAFT_0183847 antibody, DDBDRAFT_0230054 antibody, DDB_0183847 antibody, DDB_0230054 antibody, phosphoserine phosphatase antibody, phosphoserine phosphatase L homeolog antibody, PSP; O-phosphoserine phosphohydrolase; PSPase antibody, phosphoserine phosphatase SerB antibody, BPI fold containing family A member 2 antibody, PSPH antibody, Psph antibody, psph.L antibody, psph antibody, serB antibody, serB-1 antibody, LOC5568588 antibody, PSP antibody, Svir_29300 antibody, MMAH_RS03435 antibody, BPIFA2 antibody
- Background
- The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Warburg Effect
-