PSPH antibody (Middle Region)

Catalog No. ABIN632903

Product Details anti-PSPH Antibody

Target: PSPH (Phosphoserine Phosphatase (PSPH))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSPH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PSPH antibody was raised against the middle region of PSPH

Purification: Affinity purified

Immunogen: PSPH antibody was raised using the middle region of PSPH corresponding to a region with amino acids IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSPH Blocking Peptide, catalog no. 33R-4067, is also available for use as a blocking control in assays to test for specificity of this PSPH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSPH

Target: PSPH (Phosphoserine Phosphatase (PSPH))

Alternative Name: PSPH (PSPH Products)

Synonyms: PSP antibody, PSPHD antibody, AI480570 antibody, PSPase antibody, PSPH antibody, psph antibody, MGC78828 antibody, zgc:112414 antibody, DDBDRAFT_0183847 antibody, DDBDRAFT_0230054 antibody, DDB_0183847 antibody, DDB_0230054 antibody, phosphoserine phosphatase antibody, phosphoserine phosphatase L homeolog antibody, PSP; O-phosphoserine phosphohydrolase; PSPase antibody, phosphoserine phosphatase SerB antibody, BPI fold containing family A member 2 antibody, PSPH antibody, Psph antibody, psph.L antibody, psph antibody, serB antibody, serB-1 antibody, LOC5568588 antibody, PSP antibody, Svir_29300 antibody, MMAH_RS03435 antibody, BPIFA2 antibody

Background: The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Warburg Effect