RWDD1 antibody (Middle Region)
-
- Target See all RWDD1 Antibodies
- RWDD1 (RWD Domain Containing 1 (RWDD1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RWDD1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RWDD1 antibody was raised against the middle region of RWDD1
- Purification
- Affinity purified
- Immunogen
- RWDD1 antibody was raised using the middle region of RWDD1 corresponding to a region with amino acids KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ
- Top Product
- Discover our top product RWDD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RWDD1 Blocking Peptide, catalog no. 33R-4491, is also available for use as a blocking control in assays to test for specificity of this RWDD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RWDD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RWDD1 (RWD Domain Containing 1 (RWDD1))
- Alternative Name
- RWDD1 (RWDD1 Products)
- Synonyms
- PTD013 antibody, 0710001K08Rik antibody, 2610002D06Rik antibody, 2700069A07Rik antibody, IH1 antibody, sarip antibody, RWD domain containing 1 antibody, RWDD1 antibody, Rwdd1 antibody
- Background
- The RWDD1 protein protects DRG2 from proteolytic degradation.
- Molecular Weight
- 17 kDa (MW of target protein)
-