RNPEPL1 antibody
-
- Target See all RNPEPL1 products
- RNPEPL1 (Arginyl Aminopeptidase (Aminopeptidase B)-Like 1 (RNPEPL1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNPEPL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RNPEPL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYD
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNPEPL1 Blocking Peptide, catalog no. 33R-5096, is also available for use as a blocking control in assays to test for specificity of this RNPEPL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNPEPL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNPEPL1 (Arginyl Aminopeptidase (Aminopeptidase B)-Like 1 (RNPEPL1))
- Alternative Name
- RNPEPL1 (RNPEPL1 Products)
- Synonyms
- arginyl aminopeptidase like 1 antibody, arginyl aminopeptidase (aminopeptidase B)-like 1 L homeolog antibody, arginyl aminopeptidase-like 1 antibody, arginyl aminopeptidase (aminopeptidase B)-like 1 antibody, RNPEPL1 antibody, rnpepl1.L antibody, LOC511497 antibody, rnpepl1 antibody
- Background
- RNPEPL1 is thought to posess aminopeptidase activity.
- Molecular Weight
- 55 kDa (MW of target protein)
-