RAB22A antibody (Middle Region)
-
- Target See all RAB22A Antibodies
- RAB22A (RAB22A, Member RAS Oncogene Family (RAB22A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAB22A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RAB22 A antibody was raised against the middle region of RAB22
- Purification
- Affinity purified
- Immunogen
- RAB22 A antibody was raised using the middle region of RAB22 corresponding to a region with amino acids IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS
- Top Product
- Discover our top product RAB22A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAB22A Blocking Peptide, catalog no. 33R-3964, is also available for use as a blocking control in assays to test for specificity of this RAB22A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB22A (RAB22A, Member RAS Oncogene Family (RAB22A))
- Alternative Name
- RAB22A (RAB22A Products)
- Synonyms
- 3732413A17Rik antibody, AI662177 antibody, AW319644 antibody, AW550514 antibody, E130120E14Rik antibody, Rab22 antibody, RAB22 antibody, RAB22A, member RAS oncogene family antibody, Rab22a antibody, RAB22A antibody
- Background
- The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom
- Molecular Weight
- 22 kDa (MW of target protein)
-