LACTB2 antibody (Middle Region)
-
- Target See all LACTB2 Antibodies
- LACTB2 (Lactamase, beta 2 (LACTB2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LACTB2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Beta Lactamase 2 antibody was raised against the middle region of LACTB2
- Purification
- Affinity purified
- Immunogen
- Beta Lactamase 2 antibody was raised using the middle region of LACTB2 corresponding to a region with amino acids NPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEE
- Top Product
- Discover our top product LACTB2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Beta Lactamase 2 Blocking Peptide, catalog no. 33R-6830, is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LACTB2 (Lactamase, beta 2 (LACTB2))
- Abstract
- LACTB2 Products
- Synonyms
- Cgi-83 antibody, E430032H21Rik antibody, lactb2 antibody, lactamase beta 2 antibody, lactamase beta 2 L homeolog antibody, lactamase, beta 2 antibody, LACTB2 antibody, lactb2.L antibody, Lactb2 antibody, lactb2 antibody
- Background
- The specific function of LACTB2 is not yet known.
- Molecular Weight
- 33 kDa (MW of target protein)
-