LACTB2 antibody (Middle Region)

Catalog No. ABIN632991

Product Details anti-LACTB2 Antibody

Target: LACTB2 (Lactamase, beta 2 (LACTB2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LACTB2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Beta Lactamase 2 antibody was raised against the middle region of LACTB2

Purification: Affinity purified

Immunogen: Beta Lactamase 2 antibody was raised using the middle region of LACTB2 corresponding to a region with amino acids NPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Beta Lactamase 2 Blocking Peptide, catalog no. 33R-6830, is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LACTB2

Target: LACTB2 (Lactamase, beta 2 (LACTB2))

Abstract: LACTB2 Products

Synonyms: Cgi-83 antibody, E430032H21Rik antibody, lactb2 antibody, lactamase beta 2 antibody, lactamase beta 2 L homeolog antibody, lactamase, beta 2 antibody, LACTB2 antibody, lactb2.L antibody, Lactb2 antibody, lactb2 antibody

Background: The specific function of LACTB2 is not yet known.

Molecular Weight: 33 kDa (MW of target protein)