Ribose 5-Phosphate Isomerase A (RPIA) antibody
-
- Target See all Ribose 5-Phosphate Isomerase A (RPIA) Antibodies
- Ribose 5-Phosphate Isomerase A (RPIA)
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG
- Top Product
- Discover our top product RPIA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPIA Blocking Peptide, catalog no. 33R-6341, is also available for use as a blocking control in assays to test for specificity of this RPIA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPIA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Ribose 5-Phosphate Isomerase A (RPIA)
- Alternative Name
- RPIA (RPIA Products)
- Synonyms
- MGC83218 antibody, RPI antibody, zgc:103524 antibody, ribose 5-phosphate isomerase A L homeolog antibody, ribose-5-phosphate isomerase antibody, ribose 5-phosphate isomerase A antibody, ribose 5-phosphate isomerase A (ribose 5-phosphate epimerase) antibody, rpia.L antibody, LOC475755 antibody, RPIA antibody, MSP_RS04925 antibody, EAMY_RS20365 antibody, Rpia antibody, rpia antibody
- Background
- Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency. The exact function of RPIA remains unknown.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process, Ribonucleoside Biosynthetic Process
-