KANK3 antibody (N-Term)
-
- Target See all KANK3 products
- KANK3 (KN Motif and Ankyrin Repeat Domains 3 (KANK3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KANK3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ANKRD47 antibody was raised against the N terminal Of Ankrd47
- Purification
- Affinity purified
- Immunogen
- ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids MAKFALNQNLPDLGGPRLCPVPAAGGARSPSSPYSVETPYGFHLDLDFLK
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ANKRD47 Blocking Peptide, catalog no. 33R-5677, is also available for use as a blocking control in assays to test for specificity of this ANKRD47 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD47 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KANK3 (KN Motif and Ankyrin Repeat Domains 3 (KANK3))
- Alternative Name
- ANKRD47 (KANK3 Products)
- Synonyms
- ANKRD47 antibody, 0610013D04Rik antibody, Ankrd47 antibody, D17Ertd288e antibody, NG28 antibody, RGD1308853 antibody, KN motif and ankyrin repeat domains 3 antibody, KANK3 antibody, Kank3 antibody
- Background
- The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 86 kDa (MW of target protein)
-