PRPS2 antibody (N-Term)
-
- Target See all PRPS2 Antibodies
- PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRPS2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRPS2 antibody was raised against the N terminal of PRPS2
- Purification
- Affinity purified
- Immunogen
- PRPS2 antibody was raised using the N terminal of PRPS2 corresponding to a region with amino acids PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGE
- Top Product
- Discover our top product PRPS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRPS2 Blocking Peptide, catalog no. 33R-7234, is also available for use as a blocking control in assays to test for specificity of this PRPS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))
- Alternative Name
- PRPS2 (PRPS2 Products)
- Synonyms
- prsii antibody, PRSII antibody, 2610101M19Rik antibody, AA589463 antibody, AI464149 antibody, Prps-2 antibody, phosphoribosyl pyrophosphate synthetase 2 L homeolog antibody, phosphoribosyl pyrophosphate synthetase 2 antibody, prps2.L antibody, PRPS2 antibody, Prps2 antibody
- Background
- PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The encoded protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-