MFN1 antibody (Middle Region)

Catalog No. ABIN633040

Product Details anti-MFN1 Antibody

Target: MFN1 (Mitofusin 1 (MFN1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MFN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Mitofusin 1 antibody was raised against the middle region of MFN1

Purification: Affinity purified

Immunogen: Mitofusin 1 antibody was raised using the middle region of MFN1 corresponding to a region with amino acids QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Mitofusin 1 Blocking Peptide, catalog no. 33R-7768, is also available for use as a blocking control in assays to test for specificity of this Mitofusin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MFN1

Target: MFN1 (Mitofusin 1 (MFN1))

Alternative Name: Mitofusin 1 (MFN1 Products)

Synonyms: mfn1 antibody, zgc:66150 antibody, mitofusin-1 antibody, MFN1 antibody, MFN2 antibody, hfzo1 antibody, hfzo2 antibody, 2310002F04Rik antibody, 6330416C07Rik antibody, D3Ertd265e antibody, HR2 antibody, mKIAA4032 antibody, Fzo1b antibody, mitofusin 1b antibody, mitofusin 1 antibody, mitofusin 1 S homeolog antibody, mfn1b antibody, MFN1 antibody, mfn1.S antibody, mfn1 antibody, Mfn1 antibody

Background: The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.

Molecular Weight: 84 kDa (MW of target protein)