KLHL2 antibody
-
- Target See all KLHL2 Antibodies
- KLHL2 (Kelch-Like 2, Mayven (KLHL2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KLHL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- KLHL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN
- Top Product
- Discover our top product KLHL2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KLHL2 Blocking Peptide, catalog no. 33R-9385, is also available for use as a blocking control in assays to test for specificity of this KLHL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLHL2 (Kelch-Like 2, Mayven (KLHL2))
- Alternative Name
- KLHL2 (KLHL2 Products)
- Synonyms
- 6030411N21Rik antibody, ABP-KELCH antibody, AU020744 antibody, Mav antibody, mKIAA4249 antibody, MAV antibody, MAYVEN antibody, kelch-like family member 2 antibody, kelch like family member 2 antibody, kelch-like 2, Mayven antibody, Klhl2 antibody, KLHL2 antibody
- Background
- KLHL2 may play a role in organizing the actin cytoskeleton of the brain cells.
- Molecular Weight
- 66 kDa (MW of target protein)
-