KLHL2 antibody

Catalog No. ABIN633041

Product Details anti-KLHL2 Antibody

Target: KLHL2 (Kelch-Like 2, Mayven (KLHL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHL2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: KLHL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHL2 Blocking Peptide, catalog no. 33R-9385, is also available for use as a blocking control in assays to test for specificity of this KLHL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHL2

Target: KLHL2 (Kelch-Like 2, Mayven (KLHL2))

Alternative Name: KLHL2 (KLHL2 Products)

Synonyms: 6030411N21Rik antibody, ABP-KELCH antibody, AU020744 antibody, Mav antibody, mKIAA4249 antibody, MAV antibody, MAYVEN antibody, kelch-like family member 2 antibody, kelch like family member 2 antibody, kelch-like 2, Mayven antibody, Klhl2 antibody, KLHL2 antibody

Background: KLHL2 may play a role in organizing the actin cytoskeleton of the brain cells.

Molecular Weight: 66 kDa (MW of target protein)