TUBG2 antibody (Middle Region)
-
- Target See all TUBG2 Antibodies
- TUBG2 (Tubulin, gamma 2 (TUBG2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TUBG2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Gamma Tubulin 2 antibody was raised against the middle region of TUBG2
- Purification
- Affinity purified
- Immunogen
- Gamma Tubulin 2 antibody was raised using the middle region of TUBG2 corresponding to a region with amino acids FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI
- Top Product
- Discover our top product TUBG2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Gamma Tubulin 2 Blocking Peptide, catalog no. 33R-2866, is also available for use as a blocking control in assays to test for specificity of this Gamma Tubulin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TUBG2 (Tubulin, gamma 2 (TUBG2))
- Abstract
- TUBG2 Products
- Synonyms
- ARABIDOPSIS THALIANA GAMMA-TUBULIN COMPLEX PROTEIN 2 antibody, ATGCP2 antibody, GAMMA-TUBULIN 2 antibody, MJJ3.10 antibody, MJJ3_10 antibody, TUBG2 antibody, gamma-tubulin complex protein 2 antibody, AI504772 antibody, Tubgl antibody, gamma-tubulin antibody, gamma-tubulin complex protein 2 antibody, tubulin gamma 2 antibody, tubulin, gamma 2 antibody, TUBG2 antibody, GCP2 antibody, Tubg2 antibody
- Background
- Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome, suggesting that it is involved in the minus-end nucleation of microtubule assembly.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- Microtubule Dynamics, M Phase
-