CFDP1 antibody (Middle Region)
-
- Target See all CFDP1 Antibodies
- CFDP1 (Craniofacial Development Protein 1 (CFDP1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CFDP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CFDP1 antibody was raised against the middle region of CFDP1
- Purification
- Affinity purified
- Immunogen
- CFDP1 antibody was raised using the middle region of CFDP1 corresponding to a region with amino acids GSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIH
- Top Product
- Discover our top product CFDP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CFDP1 Blocking Peptide, catalog no. 33R-3561, is also available for use as a blocking control in assays to test for specificity of this CFDP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CFDP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CFDP1 (Craniofacial Development Protein 1 (CFDP1))
- Alternative Name
- CFDP1 (CFDP1 Products)
- Synonyms
- CFDP1 antibody, cfdp1 antibody, fi15f05 antibody, MGC136405 antibody, wu:fi15f05 antibody, zgc:136405 antibody, BCNT antibody, BUCENTAUR antibody, CENP-29 antibody, CP27 antibody, SWC5 antibody, Yeti antibody, p97 antibody, AA408409 antibody, Bcnt antibody, Bucentaur antibody, Cfdp antibody, cp27 antibody, bcnt antibody, P97 antibody, craniofacial development protein 1 antibody, CFDP1 antibody, cfdp1 antibody, CpipJ_CPIJ018830 antibody, LOC100282347 antibody, Cfdp1 antibody
- Background
- CFDP1 may play a role during embryogenesis.
- Molecular Weight
- 33 kDa (MW of target protein)
-