CRP antibody (N-Term)

Catalog No. ABIN633100

Product Details anti-CRP Antibody

Target: CRP (C-Reactive Protein (CRP))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CRP antibody was raised against the N terminal of CRP

Purification: Affinity purified

Immunogen: CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CRP Blocking Peptide, catalog no. 33R-5929, is also available for use as a blocking control in assays to test for specificity of this CRP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRP

Target: CRP (C-Reactive Protein (CRP))

Alternative Name: C-Reactive Protein (CRP Products)

Synonyms: PTX1 antibody, crp antibody, AI255847 antibody, Aa1249 antibody, Ab1-341 antibody, Ab2-196 antibody, Ac1-114 antibody, Ac1262 antibody, Ac2-069 antibody, Ba2-693 antibody, APCS antibody, 0610010I23Rik antibody, AW743261 antibody, C77570 antibody, CRP2 antibody, CRP4 antibody, Crp antibody, ESP1 antibody, Hlp antibody, CRP5.1 antibody, zgc:152809 antibody, C-reactive protein antibody, C-reactive protein, pentraxin-related antibody, c-reactive protein, pentraxin-related antibody, cysteine rich protein 2 antibody, CRP antibody, crp antibody, Crp antibody, Crip2 antibody, LOC776376 antibody

Background: The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognise foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis