COX7B antibody (N-Term)

Catalog No. ABIN633101

Product Details anti-COX7B Antibody

Target: COX7B (Cytochrome C Oxidase Subunit VIIb (COX7B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COX7B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: COX7 B antibody was raised against the N terminal of COX7

Purification: Affinity purified

Immunogen: COX7 B antibody was raised using the N terminal of COX7 corresponding to a region with amino acids MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COX7B Blocking Peptide, catalog no. 33R-6000, is also available for use as a blocking control in assays to test for specificity of this COX7B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COX7B

Target: COX7B (Cytochrome C Oxidase Subunit VIIb (COX7B))

Alternative Name: COX7B (COX7B Products)

Synonyms: APLCC antibody, 1100001F07Rik antibody, 1110004F07Rik antibody, C80563 antibody, MGC86432 antibody, MGC147245 antibody, fk47c09 antibody, wu:fk47c09 antibody, zgc:194876 antibody, IHQ antibody, cytochrome c oxidase subunit 7B antibody, cytochrome c oxidase subunit VIIb antibody, cytochrome c oxidase subunit VIIb L homeolog antibody, COX7B antibody, Cox7b antibody, cox7b.L antibody, cox7b antibody

Background: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIb, which is highly similar to bovine COX VIIb protein and is found in all tissues. This gene may have several pseudogenes on chromosomes 1, 2, 20 and 22, respectively.

Molecular Weight: 6 kDa (MW of target protein)

Pathways: Proton Transport