OST alpha antibody (Middle Region)

Catalog No. ABIN633166

Product Details anti-OST alpha Antibody

Target: OST alpha (OSTALPHA) (Organic Solute Transporter alpha (OSTALPHA))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OST alpha antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OSTalpha antibody was raised against the middle region of OSTalpha

Purification: Affinity purified

Immunogen: OSTalpha antibody was raised using the middle region of OSTalpha corresponding to a region with amino acids LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OSTalpha Blocking Peptide, catalog no. 33R-5169, is also available for use as a blocking control in assays to test for specificity of this OSTalpha antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSTalpha antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OST alpha

Target: OST alpha (OSTALPHA) (Organic Solute Transporter alpha (OSTALPHA))

Alternative Name: OSTalpha (OSTALPHA Products)

Synonyms: Osta antibody, Ostalpha antibody, RGD1311100 antibody, OSTA antibody, OSTalpha antibody, AV001382 antibody, AW261577 antibody, D630035O19Rik antibody, OSTALPHA antibody, solute carrier family 51, alpha subunit antibody, solute carrier family 51 alpha subunit antibody, Slc51a antibody, SLC51A antibody

Background: OSTalpha is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. OSTalpha efficiently transports the major species of bile acids.

Molecular Weight: 38 kDa (MW of target protein)