MBL2 antibody (Middle Region)

Catalog No. ABIN633169

Product Details anti-MBL2 Antibody

Target: MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MBL2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MBL2 antibody was raised against the middle region of MBL2

Purification: Affinity purified

Immunogen: MBL2 antibody was raised using the middle region of MBL2 corresponding to a region with amino acids KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MBL2 Blocking Peptide, catalog no. 33R-4323, is also available for use as a blocking control in assays to test for specificity of this MBL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MBL2

Target: MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))

Alternative Name: MBL2 (MBL2 Products)

Synonyms: COLEC1 antibody, HSMBPC antibody, MBL antibody, MBL2D antibody, MBP antibody, MBP-C antibody, MBP1 antibody, MBPD antibody, pMBP-27 antibody, mbl2 antibody, MBL1 antibody, cMBl antibody, collectin antibody, Ab2-001 antibody, Ab2-011 antibody, L-MBP antibody, MBL-C antibody, COLEC2 antibody, mbl antibody, etID42583.2 antibody, fb68b07 antibody, hbl3 antibody, wu:fb68b07 antibody, zgc:109836 antibody, mannose binding lectin 2 antibody, Mannose-binding protein C antibody, mannose-binding lectin (protein C) 2, soluble antibody, mannose-binding lectin (protein C) 2 antibody, mannose-binding lectin family member 3, pseudogene antibody, MBL2 antibody, mbl2 antibody, Mbl2 antibody, MBL3P antibody

Background: This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognises mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Complement System, Positive Regulation of Immune Effector Process