PTBP1 antibody (N-Term)
-
- Target See all PTBP1 Antibodies
- PTBP1 (Polypyrimidine Tract Binding Protein 1 (PTBP1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTBP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PTBP1 antibody was raised against the N terminal of PTBP1
- Purification
- Affinity purified
- Immunogen
- PTBP1 antibody was raised using the N terminal of PTBP1 corresponding to a region with amino acids RGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHI
- Top Product
- Discover our top product PTBP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTBP1 Blocking Peptide, catalog no. 33R-7938, is also available for use as a blocking control in assays to test for specificity of this PTBP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTBP1 (Polypyrimidine Tract Binding Protein 1 (PTBP1))
- Alternative Name
- PTBP1 (PTBP1 Products)
- Synonyms
- HNRNP-I antibody, HNRNPI antibody, HNRPI antibody, PTB antibody, PTB-1 antibody, PTB-T antibody, PTB2 antibody, PTB3 antibody, PTB4 antibody, pPTB antibody, Ptb antibody, hnrpi antibody, hnrnp-I antibody, vgrbp60 antibody, AA407203 antibody, AL033359 antibody, Pybp antibody, Pybp1 antibody, Pybp2 antibody, ptbp1 antibody, wu:fb99f12 antibody, zgc:110689 antibody, ptb antibody, ATPTB1 antibody, POLYPYRIMIDINE TRACT-BINDING antibody, POLYPYRIMIDINE TRACT-BINDING PROTEIN 1 antibody, T4P13.16 antibody, T4P13_16 antibody, polypyrimidine tract-binding protein 1 antibody, PTBP1 antibody, polypyrimidine tract binding protein 1 antibody, polypyrimidine tract binding protein 1 S homeolog antibody, polypyrimidine tract-binding protein antibody, polypyrimidine tract binding protein 1a antibody, polypyrimidine tract binding protein 1 L homeolog antibody, polypyrimidine tract-binding protein 1 antibody, PTBP1 antibody, ptbp1.S antibody, NAEGRDRAFT_80143 antibody, LOC100285404 antibody, Ptbp1 antibody, ptbp1a antibody, ptbp1.L antibody, PTB1 antibody, LOC100061673 antibody
- Background
- PTBP1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport.
- Molecular Weight
- 58 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation
-