CSTF2 antibody (N-Term)
-
- Target See all CSTF2 Antibodies
- CSTF2 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa (CSTF2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CSTF2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CSTF2 antibody was raised against the N terminal of CSTF2
- Purification
- Affinity purified
- Immunogen
- CSTF2 antibody was raised using the N terminal of CSTF2 corresponding to a region with amino acids VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA
- Top Product
- Discover our top product CSTF2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CSTF2 Blocking Peptide, catalog no. 33R-9471, is also available for use as a blocking control in assays to test for specificity of this CSTF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSTF2 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa (CSTF2))
- Alternative Name
- CSTF2 (CSTF2 Products)
- Synonyms
- CSTF2 antibody, CstF-64 antibody, fb11e07 antibody, zgc:56346 antibody, zgc:77730 antibody, wu:fb11e07 antibody, 64kDa antibody, C630034J23Rik antibody, Cstf64 antibody, CSFT64 antibody, cstF-64 antibody, cstf-64 antibody, cleavage stimulation factor subunit 2 antibody, cleavage stimulation factor, 3' pre-RNA, subunit 2 antibody, cleavage stimulation factor, 3' pre-RNA subunit 2 antibody, CSTF2 antibody, cstf2 antibody, Cstf2 antibody, cstf2.L antibody
- Background
- CSTF2 is a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs.
- Molecular Weight
- 61 kDa (MW of target protein)
-