HNRNPAB antibody (N-Term)
-
- Target See all HNRNPAB Antibodies
- HNRNPAB (Heterogeneous Nuclear Ribonucleoprotein A/B (HNRNPAB))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNRNPAB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HNRPAB antibody was raised against the N terminal Of Hnrpab
- Purification
- Affinity purified
- Immunogen
- HNRPAB antibody was raised using the N terminal Of Hnrpab corresponding to a region with amino acids GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK
- Top Product
- Discover our top product HNRNPAB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HNRPAB Blocking Peptide, catalog no. 33R-3144, is also available for use as a blocking control in assays to test for specificity of this HNRPAB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPAB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPAB (Heterogeneous Nuclear Ribonucleoprotein A/B (HNRNPAB))
- Alternative Name
- HNRPAB (HNRNPAB Products)
- Synonyms
- fd36h02 antibody, wu:fd36h02 antibody, ABBP1 antibody, HNRPAB antibody, 3010025C11Rik antibody, CBF-A antibody, Cgbfa antibody, Hnrpab antibody, A1F-C1 antibody, hm:zeh1271 antibody, hnrpab antibody, wu:fa18g02 antibody, wu:fb07b06 antibody, wu:fb16c05 antibody, zeh1271 antibody, HNRNP A/B antibody, heterogeneous nuclear ribonucleoprotein A/Bb antibody, heterogeneous nuclear ribonucleoprotein A/B antibody, heterogeneous nuclear ribonucleoprotein A/Ba antibody, heterogeneous nuclear ribonucleoprotein A/B L homeolog antibody, hnrnpabb antibody, hnrnpab antibody, HNRNPAB antibody, Hnrnpab antibody, hnrnpaba antibody, hnrnpab.L antibody
- Background
- This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes.
- Molecular Weight
- 36 kDa (MW of target protein)
-