SNRPD1 antibody (N-Term)

Catalog No. ABIN633274

Product Details anti-SNRPD1 Antibody

Target: SNRPD1 (Small Nuclear Ribonucleoprotein D1 Polypeptide 16kDa (SNRPD1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRPD1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SNRPD1 antibody was raised against the N terminal of SNRPD1

Purification: Affinity purified

Immunogen: SNRPD1 antibody was raised using the N terminal of SNRPD1 corresponding to a region with amino acids NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRPD1 Blocking Peptide, catalog no. 33R-6711, is also available for use as a blocking control in assays to test for specificity of this SNRPD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRPD1

Target: SNRPD1 (Small Nuclear Ribonucleoprotein D1 Polypeptide 16kDa (SNRPD1))

Alternative Name: SNRPD1 (SNRPD1 Products)

Synonyms: HsT2456 antibody, SMD1 antibody, SNRPD antibody, Sm-D1 antibody, SNRPD2 antibody, AA407109 antibody, AL023031 antibody, CHUNP6882 antibody, fk26a01 antibody, snprd1 antibody, snrnpd1 antibody, wu:fk26a01 antibody, zgc:86929 antibody, small nuclear ribonucleoprotein D1 polypeptide antibody, small nuclear ribonucleoprotein D1 antibody, small nuclear ribonucleoprotein D1 polypeptide L homeolog antibody, SNRPD1 antibody, Snrpd1 antibody, snrpd1 antibody, snrpd1.L antibody

Background: SNRPD1 is a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA.

Molecular Weight: 13 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization