DGCR8 antibody (N-Term)

Catalog No. ABIN633303

Product Details anti-DGCR8 Antibody

Target: DGCR8 (DiGeorge Syndrome Critical Region Gene 8 (DGCR8))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DGCR8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DGCR8 antibody was raised against the N terminal of DGCR8

Purification: Affinity purified

Immunogen: DGCR8 antibody was raised using the N terminal of DGCR8 corresponding to a region with amino acids DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DGCR8 Blocking Peptide, catalog no. 33R-2021, is also available for use as a blocking control in assays to test for specificity of this DGCR8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DGCR8

Target: DGCR8 (DiGeorge Syndrome Critical Region Gene 8 (DGCR8))

Alternative Name: DGCR8 (DGCR8 Products)

Synonyms: MGC78846 antibody, DGCR8 antibody, gy1 antibody, dgcrk6 antibody, C22orf12 antibody, DGCRK6 antibody, Gy1 antibody, pasha antibody, D16H22S1742E antibody, D16H22S788E antibody, D16Wis2 antibody, N41 antibody, Vo59c07 antibody, si:ch211-106a19.4 antibody, wu:fc23f08 antibody, wu:fc38f06 antibody, DGCR8 microprocessor complex subunit L homeolog antibody, DiGeorge syndrome critical region gene 8 antibody, DGCR8 microprocessor complex subunit antibody, DGCR8, microprocessor complex subunit antibody, microRNA 3618 antibody, dgcr8.L antibody, DGCR8 antibody, dgcr8 antibody, Dgcr8 antibody, MIR3618 antibody

Background: DGCR8 contains 2 DRBM (double-stranded RNA-binding) domains and 1 WW domain. It may play a part in the etiology of the velocardiofacial/DiGeorge syndrome (VCFS/DGS), a developmental disorder characterized by structural and functional palate anomalies, conotruncal cardiac malformations, immunodeficiency, hypocalcemia, and typical facial anomalies.

Molecular Weight: 85 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways