ZRSR2 antibody
-
- Target See all ZRSR2 Antibodies
- ZRSR2 (Zinc Finger (CCCH Type), RNA-Binding Motif and serine/arginine Rich 2 (ZRSR2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZRSR2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ZRSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNP
- Top Product
- Discover our top product ZRSR2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZRSR2 Blocking Peptide, catalog no. 33R-5084, is also available for use as a blocking control in assays to test for specificity of this ZRSR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZRSR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZRSR2 (Zinc Finger (CCCH Type), RNA-Binding Motif and serine/arginine Rich 2 (ZRSR2))
- Alternative Name
- ZRSR2 (ZRSR2 Products)
- Synonyms
- ZRSR2 antibody, 35kDa antibody, 5031411E02Rik antibody, A230052C13Rik antibody, C77286 antibody, U2af1-rs2 antibody, URP antibody, RGD1559763 antibody, U2AF1-RS2 antibody, U2AF1L2 antibody, U2AF1RS2 antibody, fb73a09 antibody, wu:fb73a09 antibody, zinc finger CCCH-type, RNA binding motif and serine/arginine rich 2 antibody, zinc finger (CCCH type), RNA binding motif and serine/arginine rich 2 antibody, zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2 antibody, ZRSR2 antibody, zrsr2 antibody, ZRSR2Y antibody, Zrsr2 antibody
- Background
- ZRSR2 is an essential splicing factor. The protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3' splice site in pre-mRNA splicing.
- Molecular Weight
- 58 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-