STRBP antibody (Middle Region)
-
- Target See all STRBP Antibodies
- STRBP (Spermatid Perinuclear RNA Binding Protein (STRBP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This STRBP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- STRBP antibody was raised against the middle region of STRBP
- Purification
- Affinity purified
- Immunogen
- STRBP antibody was raised using the middle region of STRBP corresponding to a region with amino acids PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNS
- Top Product
- Discover our top product STRBP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
STRBP Blocking Peptide, catalog no. 33R-7353, is also available for use as a blocking control in assays to test for specificity of this STRBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STRBP (Spermatid Perinuclear RNA Binding Protein (STRBP))
- Alternative Name
- STRBP (STRBP Products)
- Synonyms
- ILF3L antibody, SPNR antibody, p74 antibody, 6430510M02Rik antibody, AI852513 antibody, C230082I21Rik antibody, C86322 antibody, Spnr antibody, spermatid perinuclear RNA binding protein L homeolog antibody, spermatid perinuclear RNA binding protein antibody, strbp.L antibody, STRBP antibody, Strbp antibody
- Background
- STRBP contains 2 DRBM (double-stranded RNA-binding) domains and 1 DZF domain. STRBP is involved in spermatogenesis and sperm function. It plays a role in regulation of cell growth.
- Molecular Weight
- 74 kDa (MW of target protein)
-