KHSRP antibody (Middle Region)

Catalog No. ABIN633384

Product Details anti-KHSRP Antibody

Target: KHSRP (KH-Type Splicing Regulatory Protein (KHSRP))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KHSRP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KHSRP antibody was raised against the middle region of KHSRP

Purification: Affinity purified

Immunogen: KHSRP antibody was raised using the middle region of KHSRP corresponding to a region with amino acids WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KHSRP Blocking Peptide, catalog no. 33R-9939, is also available for use as a blocking control in assays to test for specificity of this KHSRP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHSRP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KHSRP

Target: KHSRP (KH-Type Splicing Regulatory Protein (KHSRP))

Alternative Name: KHSRP (KHSRP Products)

Synonyms: FBP2 antibody, FUBP2 antibody, KSRP antibody, 6330409F21Rik antibody, Fbp2 antibody, Fubp2 antibody, Ksrp antibody, Marta1 antibody, KHSRP antibody, VgRBP71 antibody, fbp2 antibody, ksrp antibody, fubp2 antibody, fc94c12 antibody, wu:fb25b12 antibody, wu:fc10e10 antibody, wu:fc94c12 antibody, zgc:163038 antibody, khsrp-b antibody, KH-type splicing regulatory protein antibody, KH-type splicing regulatory protein L homeolog antibody, KH-type splicing regulatory protein S homeolog antibody, KHSRP antibody, Khsrp antibody, khsrp.L antibody, khsrp antibody, khsrp.S antibody

Background: KHSRP binds to the dendritic targeting element and may play a role in mRNA trafficking. It is part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. KHSRP mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. It may interact with single-stranded DNA from the far-upstream element (FUSE).

Molecular Weight: 73 kDa (MW of target protein)