RBM4 antibody (C-Term)
-
- Target See all RBM4 Antibodies
- RBM4 (RNA Binding Motif Protein 4 (RBM4))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RBM4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RBM4 antibody was raised against the C terminal of RBM4
- Purification
- Affinity purified
- Immunogen
- RBM4 antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids LQQQPLLLLLQLPLHITGGIGAPCVALQPQSPLLERATVTGMRVSCPKLQ
- Top Product
- Discover our top product RBM4 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RBM4 Blocking Peptide, catalog no. 33R-5330, is also available for use as a blocking control in assays to test for specificity of this RBM4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBM4 (RNA Binding Motif Protein 4 (RBM4))
- Alternative Name
- RBM4 (RBM4 Products)
- Synonyms
- rbm4 antibody, rna-bp4 antibody, wu:fc31f07 antibody, wu:fc57h11 antibody, zgc:56302 antibody, LARK antibody, RBM4A antibody, ZCCHC21 antibody, ZCRB3A antibody, 4921506I22Rik antibody, Lark1 antibody, Mlark antibody, Rbm4a antibody, lark antibody, Rbm4 antibody, RNA binding motif protein 4.1 antibody, RNA binding motif protein 4 antibody, RNA-binding protein 14 antibody, RNA-binding protein lark antibody, rbm4.1 antibody, RBM4 antibody, LOC610648 antibody, Rbm4 antibody, LARK antibody
- Background
- RBM4 contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing. RBM4 is down-regulated in fetal Down syndrome (DS) brain.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Photoperiodism
-