ERAL1 antibody
-
- Target See all ERAL1 Antibodies
- ERAL1 (Era G-Protein-Like 1 (ERAL1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ERAL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM
- Top Product
- Discover our top product ERAL1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ERAL1 Blocking Peptide, catalog no. 33R-4675, is also available for use as a blocking control in assays to test for specificity of this ERAL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERAL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERAL1 (Era G-Protein-Like 1 (ERAL1))
- Alternative Name
- ERAL1 (ERAL1 Products)
- Synonyms
- ERAL1 antibody, 2610524P08Rik antibody, 9130407C09Rik antibody, AU019798 antibody, Era antibody, M-ERA antibody, MERA-S antibody, MERA-W antibody, GdERA antibody, si:ch211-207c6.1 antibody, ERA antibody, ERAL1A antibody, H-ERA antibody, HERA-A antibody, HERA-B antibody, eral1 antibody, Era like 12S mitochondrial rRNA chaperone 1 antibody, Era (G-protein)-like 1 (E. coli) antibody, Era-like 12S mitochondrial rRNA chaperone 1 antibody, Era-like 12S mitochondrial rRNA chaperone 1 L homeolog antibody, GTP-binding protein era homolog antibody, ERAL1 antibody, Eral1 antibody, eral1 antibody, eral1.L antibody, eral antibody
- Background
- The function of ERAL protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 48 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-