PUM2 antibody

Catalog No. ABIN633445

Product Details anti-PUM2 Antibody

Target: PUM2 (Pumilio Homolog 2 (Drosophila) (PUM2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PUM2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PUM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PUM2 Blocking Peptide, catalog no. 33R-6245, is also available for use as a blocking control in assays to test for specificity of this PUM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PUM2

Target: PUM2 (Pumilio Homolog 2 (Drosophila) (PUM2))

Alternative Name: PUM2 (PUM2 Products)

Synonyms: pum-2 antibody, 5730503J23Rik antibody, Pumm2 antibody, mKIAA0235 antibody, PUMH2 antibody, PUML2 antibody, pumilio RNA binding family member 2 antibody, pumilio RNA-binding family member 2 antibody, pum2 antibody, Pum2 antibody, PUM2 antibody

Background: PUM2 is a sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of mRNA targets. Its interactions and tissue specificity suggest that it may be required to support proliferation and self-renewal of stem cells by regulating the translation of key transcripts.

Molecular Weight: 114 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization