PUM2 antibody
-
- Target See all PUM2 Antibodies
- PUM2 (Pumilio Homolog 2 (Drosophila) (PUM2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PUM2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PUM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAW
- Top Product
- Discover our top product PUM2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PUM2 Blocking Peptide, catalog no. 33R-6245, is also available for use as a blocking control in assays to test for specificity of this PUM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PUM2 (Pumilio Homolog 2 (Drosophila) (PUM2))
- Alternative Name
- PUM2 (PUM2 Products)
- Synonyms
- pum-2 antibody, 5730503J23Rik antibody, Pumm2 antibody, mKIAA0235 antibody, PUMH2 antibody, PUML2 antibody, pumilio RNA binding family member 2 antibody, pumilio RNA-binding family member 2 antibody, pum2 antibody, Pum2 antibody, PUM2 antibody
- Background
- PUM2 is a sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of mRNA targets. Its interactions and tissue specificity suggest that it may be required to support proliferation and self-renewal of stem cells by regulating the translation of key transcripts.
- Molecular Weight
- 114 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-