EIF4A2 antibody (N-Term)

Catalog No. ABIN633476

Product Details anti-EIF4A2 Antibody

Target: EIF4A2 (Eukaryotic Translation Initiation Factor 4A2 (EIF4A2))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF4A2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EIF4 A2 antibody was raised against the N terminal of EIF4 2

Purification: Affinity purified

Immunogen: EIF4 A2 antibody was raised using the N terminal of EIF4 2 corresponding to a region with amino acids MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYA

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF4A2 Blocking Peptide, catalog no. 33R-6430, is also available for use as a blocking control in assays to test for specificity of this EIF4A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF4A2

Target: EIF4A2 (Eukaryotic Translation Initiation Factor 4A2 (EIF4A2))

Alternative Name: EIF4A2 (EIF4A2 Products)

Synonyms: BM-010 antibody, DDX2B antibody, EIF4A antibody, EIF4F antibody, eIF-4A-II antibody, eIF4A-II antibody, 4833432N07Rik antibody, Ddx2b antibody, Eif4 antibody, ddx2b antibody, eif4aii antibody, eif4f antibody, xeif4aii antibody, EIF4A2 antibody, EIF4AII antibody, wu:fd50g11 antibody, zgc:63783 antibody, eukaryotic translation initiation factor 4A2 antibody, eukaryotic translation initiation factor 4A2 L homeolog antibody, microRNA 1248 antibody, eukaryotic translation initiation factor 4A, isoform 2 antibody, Eif4a2 antibody, EIF4A2 antibody, eif4a2.L antibody, eif4a2 antibody, MIR1248 antibody

Background: EIF4A2 contains 1 helicase C-terminal domain and 1 helicase ATP-binding domain. It belongs to the DEAD box helicase family. eIF4A subfamily. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5' untranslated region of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.

Molecular Weight: 45 kDa (MW of target protein)