IGF2BP2 antibody (Middle Region)

Catalog No. ABIN633482

Product Details anti-IGF2BP2 Antibody

Target: IGF2BP2 (Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGF2BP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IGF2 BP2 antibody was raised against the middle region of IGF2 P2

Purification: Affinity purified

Immunogen: IGF2 BP2 antibody was raised using the middle region of IGF2 P2 corresponding to a region with amino acids QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IGF2BP2 Blocking Peptide, catalog no. 33R-7470, is also available for use as a blocking control in assays to test for specificity of this IGF2BP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGF0 P2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGF2BP2

Target: IGF2BP2 (Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2))

Alternative Name: IGF2BP2 (IGF2BP2 Products)

Synonyms: IMP-2 antibody, IMP2 antibody, VICKZ2 antibody, p62 antibody, C330012H03Rik antibody, Imp2 antibody, Neilsen antibody, RGD1305614 antibody, insulin like growth factor 2 mRNA binding protein 2 antibody, insulin-like growth factor 2 mRNA binding protein 2 antibody, IGF2BP2 antibody, Igf2bp2 antibody

Background: IGF2BP2 binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binding is isoform-specific. IGF2BP2 may regulate translation of target mRNAs.

Molecular Weight: 66 kDa (MW of target protein)