Synaptojanin 2 antibody (N-Term)
-
- Target See all Synaptojanin 2 (SYNJ2) Antibodies
- Synaptojanin 2 (SYNJ2)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Synaptojanin 2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Synaptojanin 2 antibody was raised against the N terminal of SYNJ2
- Purification
- Affinity purified
- Immunogen
- Synaptojanin 2 antibody was raised using the N terminal of SYNJ2 corresponding to a region with amino acids SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL
- Top Product
- Discover our top product SYNJ2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Synaptojanin 2 Blocking Peptide, catalog no. 33R-8466, is also available for use as a blocking control in assays to test for specificity of this Synaptojanin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNJ2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Synaptojanin 2 (SYNJ2)
- Alternative Name
- Synaptojanin 2 (SYNJ2 Products)
- Synonyms
- SYNJ2 antibody, INPP5H antibody, AI481647 antibody, SJ2 antibody, mKIAA0348 antibody, synaptojanin 2 antibody, synaptojanin-2 antibody, SYNJ2 antibody, LOC100074269 antibody, synj2 antibody, Synj2 antibody
- Background
- SYNJ2 may play a role in allowing polymerase epsilon to carry out its replication and/or repair function.
- Molecular Weight
- 165 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-