CNOT6 antibody (N-Term)

Catalog No. ABIN633523

Product Details anti-CNOT6 Antibody

Target: CNOT6 (CCR4-NOT Transcription Complex, Subunit 6 (CNOT6))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CNOT6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CNOT6 antibody was raised against the N terminal of CNOT6

Purification: Affinity purified

Immunogen: CNOT6 antibody was raised using the N terminal of CNOT6 corresponding to a region with amino acids EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CNOT6 Blocking Peptide, catalog no. 33R-2486, is also available for use as a blocking control in assays to test for specificity of this CNOT6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNOT6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CNOT6

Target: CNOT6 (CCR4-NOT Transcription Complex, Subunit 6 (CNOT6))

Alternative Name: CNOT6 (CNOT6 Products)

Synonyms: CCR4 antibody, A230103N10Rik antibody, AA407540 antibody, AW456442 antibody, RGD1310783 antibody, wu:fa03c11 antibody, wu:fc17f01 antibody, zgc:65822 antibody, CCR4-NOT transcription complex subunit 6 antibody, CCR4-NOT transcription complex, subunit 6 antibody, CCR4-NOT transcription complex, subunit 6a antibody, CNOT6 antibody, Cnot6 antibody, cnot6a antibody, cnot6 antibody

Background: CNOT6 is a subunit of the CCR4-NOT core transcriptional regulation complex. CNOT6 has a 3'-5' RNase activity and prefers polyadenylated substates.

Molecular Weight: 63 kDa (MW of target protein)