LARP4 antibody (Middle Region)
-
- Target See all LARP4 Antibodies
- LARP4 (La Ribonucleoprotein Domain Family, Member 4 (LARP4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LARP4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LARP4 antibody was raised against the middle region of LARP4
- Purification
- Affinity purified
- Immunogen
- LARP4 antibody was raised using the middle region of LARP4 corresponding to a region with amino acids VSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQ
- Top Product
- Discover our top product LARP4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LARP4 Blocking Peptide, catalog no. 33R-9818, is also available for use as a blocking control in assays to test for specificity of this LARP4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LARP4 (La Ribonucleoprotein Domain Family, Member 4 (LARP4))
- Alternative Name
- LARP4 (LARP4 Products)
- Synonyms
- C530046N12 antibody, D330037H05Rik antibody, DXErtd793 antibody, DXErtd793e antibody, La ribonucleoprotein domain family member 4 antibody, La ribonucleoprotein domain family, member 4 antibody, LARP4 antibody, larp4 antibody, Larp4 antibody
- Background
- The function of LARP4 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 72 kDa (MW of target protein)
-