C14orf21 antibody (Middle Region)

Catalog No. ABIN633556

Product Details anti-C14orf21 Antibody

Target: C14orf21 (Chromosome 14 Open Reading Frame 21 (C14orf21))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C14orf21 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C14 ORF21 antibody was raised against the middle region of C14 rf21

Purification: Affinity purified

Immunogen: C14 ORF21 antibody was raised using the middle region of C14 rf21 corresponding to a region with amino acids GGTILESERARPRGSQSSEAQKTPAQECKPADFEVPETFLNRLQDLSSSF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C14ORF21 Blocking Peptide, catalog no. 33R-3302, is also available for use as a blocking control in assays to test for specificity of this C14ORF21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C14orf21

Target: C14orf21 (Chromosome 14 Open Reading Frame 21 (C14orf21))

Alternative Name: C14ORF21 (C14orf21 Products)

Synonyms: MGC69156 antibody, C14orf21 antibody, 2610027L16Rik antibody, NOP9 nucleolar protein L homeolog antibody, NOP9 nucleolar protein antibody, similar to S. cerevisiae YJL010C antibody, nop9.L antibody, nop9 antibody, NOP9 antibody, Nop9 antibody, CaO19.11959 antibody

Background: The specific function of C14orf21 is not yet known.

Molecular Weight: 69 kDa (MW of target protein)