C14orf21 antibody (Middle Region)
-
- Target See all C14orf21 products
- C14orf21 (Chromosome 14 Open Reading Frame 21 (C14orf21))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C14orf21 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C14 ORF21 antibody was raised against the middle region of C14 rf21
- Purification
- Affinity purified
- Immunogen
- C14 ORF21 antibody was raised using the middle region of C14 rf21 corresponding to a region with amino acids GGTILESERARPRGSQSSEAQKTPAQECKPADFEVPETFLNRLQDLSSSF
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C14ORF21 Blocking Peptide, catalog no. 33R-3302, is also available for use as a blocking control in assays to test for specificity of this C14ORF21 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF21 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C14orf21 (Chromosome 14 Open Reading Frame 21 (C14orf21))
- Alternative Name
- C14ORF21 (C14orf21 Products)
- Synonyms
- MGC69156 antibody, C14orf21 antibody, 2610027L16Rik antibody, NOP9 nucleolar protein L homeolog antibody, NOP9 nucleolar protein antibody, similar to S. cerevisiae YJL010C antibody, nop9.L antibody, nop9 antibody, NOP9 antibody, Nop9 antibody, CaO19.11959 antibody
- Background
- The specific function of C14orf21 is not yet known.
- Molecular Weight
- 69 kDa (MW of target protein)
-