RBPMS2 antibody (Middle Region)
-
- Target See all RBPMS2 Antibodies
- RBPMS2 (RNA Binding Protein with Multiple Splicing 2 (RBPMS2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RBPMS2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RBPMS2 antibody was raised against the middle region of RBPMS2
- Purification
- Affinity purified
- Immunogen
- RBPMS2 antibody was raised using the middle region of RBPMS2 corresponding to a region with amino acids ANTKMAKSKLMATPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAP
- Top Product
- Discover our top product RBPMS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RBPMS2 Blocking Peptide, catalog no. 33R-1410, is also available for use as a blocking control in assays to test for specificity of this RBPMS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBPMS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBPMS2 (RNA Binding Protein with Multiple Splicing 2 (RBPMS2))
- Alternative Name
- RBPMS2 (RBPMS2 Products)
- Synonyms
- hermes antibody, RBPMS antibody, 2400008B06Rik antibody, AI316523 antibody, RGD1561222 antibody, rbpms2 antibody, zgc:55559 antibody, zgc:77170 antibody, RNA binding protein with multiple splicing 2 L homeolog antibody, RNA binding protein with multiple splicing 2 antibody, RNA binding protein with multiple splicing 2b antibody, rbpms2.L antibody, RBPMS2 antibody, Rbpms2 antibody, rbpms2b antibody
- Background
- RBPMS2 contains 1 RRM (RNA recognition motif) domain. The exact function of RBPMS2 remains unknown.
- Molecular Weight
- 22 kDa (MW of target protein)
-