PCBP1 antibody
-
- Target See all PCBP1 Antibodies
- PCBP1 (Poly(rC) Binding Protein 1 (PCBP1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PCBP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PCBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF
- Top Product
- Discover our top product PCBP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PCBP1 Blocking Peptide, catalog no. 33R-7142, is also available for use as a blocking control in assays to test for specificity of this PCBP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCBP1 (Poly(rC) Binding Protein 1 (PCBP1))
- Alternative Name
- PCBP1 (PCBP1 Products)
- Synonyms
- PCBP1 antibody, HNRPE1 antibody, HNRPX antibody, hnRNP-E1 antibody, hnRNP-X antibody, hnRNP E1 antibody, WBP17 antibody, [a]CP-1 antibody, alphaCP-1 antibody, RGD1561319 antibody, poly(rC) binding protein 1 antibody, poly(rC) binding protein 1 L homeolog antibody, poly(rC)-binding protein 1 antibody, PCBP1 antibody, pcbp1.L antibody, LOC100388387 antibody, Pcbp1 antibody
- Background
- PCBP1 appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure.
- Molecular Weight
- 37 kDa (MW of target protein)
-