EIF4E3 antibody (Middle Region)
-
- Target See all EIF4E3 Antibodies
- EIF4E3 (Eukaryotic Translation Initiation Factor 4E Family Member 3 (EIF4E3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EIF4E3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EIF4 E3 antibody was raised against the middle region of EIF4 3
- Purification
- Affinity purified
- Immunogen
- EIF4 E3 antibody was raised using the middle region of EIF4 3 corresponding to a region with amino acids VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH
- Top Product
- Discover our top product EIF4E3 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EIF4E3 Blocking Peptide, catalog no. 33R-9766, is also available for use as a blocking control in assays to test for specificity of this EIF4E3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF4E3 (Eukaryotic Translation Initiation Factor 4E Family Member 3 (EIF4E3))
- Alternative Name
- EIF4E3 (EIF4E3 Products)
- Synonyms
- eif4e3 antibody, wu:fc31f11 antibody, wu:fd15f11 antibody, zgc:92189 antibody, DDBDRAFT_0191035 antibody, DDBDRAFT_0234256 antibody, DDB_0191035 antibody, DDB_0234256 antibody, IF4E3 antibody, 1300018P11Rik antibody, AI451927 antibody, eIF4E-3 antibody, eukaryotic translation initiation factor 4E family member 3 antibody, eukaryotic translation initiation factor 4E family member 3 L homeolog antibody, eukaryotic translation initiation factor 4E member 3 antibody, eukaryotic translation initiation factor 4E family member 3 S homeolog antibody, EIF4E3 antibody, Eif4e3 antibody, eif4e3.L antibody, eif4e3 antibody, eIF4e3 antibody, eif4e3.S antibody
- Background
- EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome.
- Molecular Weight
- 24 kDa (MW of target protein)
-