SFRS7 antibody (Middle Region)
-
- Target See all SFRS7 Antibodies
- SFRS7 (Splicing Factor, Arginine/Serine Rich 7 (SFRS7))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SFRS7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SFRS7 antibody was raised against the middle region of SFRS7
- Purification
- Affinity purified
- Immunogen
- SFRS7 antibody was raised using the middle region of SFRS7 corresponding to a region with amino acids SRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSP
- Top Product
- Discover our top product SFRS7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SFRS7 Blocking Peptide, catalog no. 33R-8776, is also available for use as a blocking control in assays to test for specificity of this SFRS7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFRS7 (Splicing Factor, Arginine/Serine Rich 7 (SFRS7))
- Alternative Name
- SFRS7 (SFRS7 Products)
- Synonyms
- 9G8 antibody, AAG3 antibody, SFRS7 antibody, 35kDa antibody, 9430065L19Rik antibody, NX-96 antibody, Sfrs7 antibody, 9g8 antibody, aag3 antibody, sfrs7 antibody, srsf7 antibody, zgc:114203 antibody, serine and arginine rich splicing factor 7 antibody, serine/arginine-rich splicing factor 7 antibody, serine/arginine-rich splicing factor 7 L homeolog antibody, serine/arginine-rich splicing factor 7b antibody, SRSF7 antibody, Srsf7 antibody, srsf7.L antibody, srsf7b antibody
- Background
- SFRS7 is required for pre-mRNA splicing. SFRS7 can also modulate alternative splicing in vitro.
- Molecular Weight
- 27 kDa (MW of target protein)
-