Ribonuclease H1 antibody (Middle Region)

Catalog No. ABIN633594

Product Details anti-Ribonuclease H1 Antibody

Target: Ribonuclease H1 (RNASEH1)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ribonuclease H1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNASEH1 antibody was raised against the middle region of RNASEH1

Purification: Affinity purified

Immunogen: RNASEH1 antibody was raised using the middle region of RNASEH1 corresponding to a region with amino acids EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNASEH1 Blocking Peptide, catalog no. 33R-2790, is also available for use as a blocking control in assays to test for specificity of this RNASEH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Ribonuclease H1

Target: Ribonuclease H1 (RNASEH1)

Alternative Name: RNASEH1 (RNASEH1 Products)

Synonyms: H1RNA antibody, RNH1 antibody, 74/9 antibody, CG8729 antibody, Dmel\\CG8729 antibody, RNase H1 antibody, RnH1 antibody, l(2)43F1-5 antibody, l(2)43Fa antibody, l(2)k07409 antibody, l(2)k07624 antibody, rnhl antibody, h1rna antibody, rnh1 antibody, zgc:91971 antibody, RNASEH1P1 antibody, RNASEH1 antibody, rnaseh1 antibody, Afu1g10020 antibody, Tb07.26A24.40 antibody, ribonuclease H1 antibody, ribonuclease H1 S homeolog antibody, ribonuclease H1 L homeolog antibody, ribonuclease HI antibody, Ribonuclease H1 antibody, RNASEH1 antibody, Rnaseh1 antibody, rnh1 antibody, rnaseh1.S antibody, rnaseh1 antibody, rnaseh1.L antibody, AFUA_1G10020 antibody, Tb927.7.4930 antibody, APH_RS00510 antibody

Background: RNASEH1 belongs to the RNase H family. It contains 1 RNase H domain. RNASEH1 is an endonuclease that specifically degrades the RNA of RNA-DNA hybrids.

Molecular Weight: 32 kDa (MW of target protein)