FXR1 antibody (C-Term)

Catalog No. ABIN633611

Product Details anti-FXR1 Antibody

Target: FXR1 (Fragile X Mental Retardation, Autosomal Homolog 1 (FXR1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FXR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FXR1 antibody was raised against the C terminal of FXR1

Purification: Affinity purified

Immunogen: FXR1 antibody was raised using the C terminal of FXR1 corresponding to a region with amino acids EQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDW

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FXR1 Blocking Peptide, catalog no. 33R-2671, is also available for use as a blocking control in assays to test for specificity of this FXR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FXR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FXR1

Target: FXR1 (Fragile X Mental Retardation, Autosomal Homolog 1 (FXR1))

Alternative Name: FXR1 (FXR1 Products)

Synonyms: FXR1P antibody, wu:fb16f11 antibody, wu:fd18c10 antibody, zgc:66226 antibody, Fxr1h antibody, Fxr1p antibody, XtFxr1p antibody, fxr1h antibody, xFxr1p antibody, FXR1 antibody, 1110050J02Rik antibody, 9530073J07Rik antibody, AI851072 antibody, xfxr1 antibody, fxr1 antibody, FMR1 autosomal homolog 1 antibody, fragile X mental retardation, autosomal homolog 1 antibody, fragile X mental retardation gene 1, autosomal homolog antibody, FMR1 autosomal homolog 1 L homeolog antibody, FMR1 autosomal homolog 1 S homeolog antibody, FXR1 antibody, fxr1 antibody, Fxr1 antibody, fxr1.L antibody, fxr1.S antibody

Background: FXR1 is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit.

Molecular Weight: 68 kDa (MW of target protein)