KCNAB1 antibody (C-Term)

Catalog No. ABIN633614

Product Details anti-KCNAB1 Antibody

Target: KCNAB1 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 1 (KCNAB1))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNAB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNAB1 antibody was raised against the C terminal of KCNAB1

Purification: Affinity purified

Immunogen: KCNAB1 antibody was raised using the C terminal of KCNAB1 corresponding to a region with amino acids VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNAB1 Blocking Peptide, catalog no. 33R-9721, is also available for use as a blocking control in assays to test for specificity of this KCNAB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNAB1

Target: KCNAB1 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 1 (KCNAB1))

Alternative Name: KCNAB1 (KCNAB1 Products)

Synonyms: KCNAB1 antibody, zgc:113627 antibody, AKR6A3 antibody, KCNA1B antibody, KV-BETA-1 antibody, Kvb1.3 antibody, hKvBeta3 antibody, hKvb3 antibody, Kvbeta1.1 antibody, KVBETA1 antibody, Kv-beta-1 antibody, Akr8a8 antibody, mKv(beta)1 antibody, KvBeta3 antibody, potassium voltage-gated channel subfamily A member regulatory beta subunit 1 antibody, potassium voltage-gated channel, shaker-related subfamily, beta member 1 a antibody, potassium voltage-gated channel, shaker-related subfamily, beta member 1 antibody, KCNAB1 antibody, kcnab1a antibody, Kcnab1 antibody

Background: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

Molecular Weight: 46 kDa (MW of target protein)