KCNAB1 antibody (C-Term)
-
- Target See all KCNAB1 Antibodies
- KCNAB1 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 1 (KCNAB1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNAB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNAB1 antibody was raised against the C terminal of KCNAB1
- Purification
- Affinity purified
- Immunogen
- KCNAB1 antibody was raised using the C terminal of KCNAB1 corresponding to a region with amino acids VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV
- Top Product
- Discover our top product KCNAB1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNAB1 Blocking Peptide, catalog no. 33R-9721, is also available for use as a blocking control in assays to test for specificity of this KCNAB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNAB1 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 1 (KCNAB1))
- Alternative Name
- KCNAB1 (KCNAB1 Products)
- Synonyms
- KCNAB1 antibody, zgc:113627 antibody, AKR6A3 antibody, KCNA1B antibody, KV-BETA-1 antibody, Kvb1.3 antibody, hKvBeta3 antibody, hKvb3 antibody, Kvbeta1.1 antibody, KVBETA1 antibody, Kv-beta-1 antibody, Akr8a8 antibody, mKv(beta)1 antibody, KvBeta3 antibody, potassium voltage-gated channel subfamily A member regulatory beta subunit 1 antibody, potassium voltage-gated channel, shaker-related subfamily, beta member 1 a antibody, potassium voltage-gated channel, shaker-related subfamily, beta member 1 antibody, KCNAB1 antibody, kcnab1a antibody, Kcnab1 antibody
- Background
- Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
- Molecular Weight
- 46 kDa (MW of target protein)
-