KCTD15 antibody (N-Term)

Catalog No. ABIN633619

Product Details anti-KCTD15 Antibody

Target: KCTD15 (Potassium Channel Tetramerisation Domain Containing 15 (KCTD15))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCTD15 antibody was raised against the N terminal of KCTD15

Purification: Affinity purified

Immunogen: KCTD15 antibody was raised using the N terminal of KCTD15 corresponding to a region with amino acids PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD15 Blocking Peptide, catalog no. 33R-7424, is also available for use as a blocking control in assays to test for specificity of this KCTD15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD15

Target: KCTD15 (Potassium Channel Tetramerisation Domain Containing 15 (KCTD15))

Alternative Name: KCTD15 (KCTD15 Products)

Synonyms: BC031749 antibody, kctd15 antibody, zgc:100865 antibody, fa02e12 antibody, kctd15l antibody, wu:fa02e12 antibody, zgc:103747 antibody, potassium channel tetramerization domain containing 15 antibody, potassium channel tetramerisation domain containing 15 antibody, potassium channel tetramerization domain containing 15 L homeolog antibody, potassium channel tetramerization domain containing 15b antibody, potassium channel tetramerization domain containing 15a antibody, KCTD15 antibody, Kctd15 antibody, kctd15.L antibody, kctd15b antibody, kctd15a antibody

Background: KCTD15 contains 1 BTB (POZ) domain. The exact function of KCTD15 is not known.

Molecular Weight: 26 kDa (MW of target protein)