CLIC6 antibody (Middle Region)
-
- Target See all CLIC6 Antibodies
- CLIC6 (Chloride Intracellular Channel 6 (CLIC6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CLIC6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CLIC6 antibody was raised against the middle region of CLIC6
- Purification
- Affinity purified
- Immunogen
- CLIC6 antibody was raised using the middle region of CLIC6 corresponding to a region with amino acids RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV
- Top Product
- Discover our top product CLIC6 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CLIC6 Blocking Peptide, catalog no. 33R-8134, is also available for use as a blocking control in assays to test for specificity of this CLIC6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLIC6 (Chloride Intracellular Channel 6 (CLIC6))
- Alternative Name
- CLIC6 (CLIC6 Products)
- Synonyms
- CLIC6 antibody, CLIC1L antibody, 5730466J16Rik antibody, AL022908 antibody, AW045520 antibody, Clic6b antibody, chloride intracellular channel 6 antibody, CLIC6 antibody, Clic6 antibody
- Background
- CLIon Channel6 encodes a member of the chloride intracellular channel family of proteins. The gene is part of a large triplicated region found on chromosomes 1, 6, and 21.
- Molecular Weight
- 75 kDa (MW of target protein)
-