VDAC2 antibody (N-Term)
-
- Target See all VDAC2 Antibodies
- VDAC2 (Voltage-Dependent Anion Channel 2 (VDAC2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VDAC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- VDAC2 antibody was raised against the N terminal of VDAC2
- Purification
- Affinity purified
- Immunogen
- VDAC2 antibody was raised using the N terminal of VDAC2 corresponding to a region with amino acids VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWN
- Top Product
- Discover our top product VDAC2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VDAC2 Blocking Peptide, catalog no. 33R-9629, is also available for use as a blocking control in assays to test for specificity of this VDAC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VDAC2 (Voltage-Dependent Anion Channel 2 (VDAC2))
- Alternative Name
- VDAC2 (VDAC2 Products)
- Synonyms
- POR antibody, Vdac6 antibody, mVDAC2 antibody, mVDAC6 antibody, wu:fa01a08 antibody, wu:fa98a10 antibody, wu:fb50g11 antibody, zgc:55795 antibody, zgc:77621 antibody, vdac2 antibody, VDAC2 antibody, ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 2 antibody, ATVDAC2 antibody, K9I9.6 antibody, K9I9_6 antibody, voltage dependent anion channel 2 antibody, voltage dependent anion channel 2 antibody, voltage-dependent anion channel 2 antibody, voltage-dependent anion channel 2 S homeolog antibody, VDAC2 antibody, Vdac2 antibody, vdac2 antibody, vdac2.S antibody
- Background
- VDAC2 forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.
- Molecular Weight
- 31 kDa (MW of target protein)
-