CACNB1 antibody (N-Term)
-
- Target See all CACNB1 Antibodies
- CACNB1 (Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Zebrafish (Danio rerio), Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CACNB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CACNB1 antibody was raised against the N terminal of CACNB1
- Purification
- Affinity purified
- Immunogen
- CACNB1 antibody was raised using the N terminal of CACNB1 corresponding to a region with amino acids EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS
- Top Product
- Discover our top product CACNB1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CACNB1 Blocking Peptide, catalog no. 33R-2782, is also available for use as a blocking control in assays to test for specificity of this CACNB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACNB1 (Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1))
- Alternative Name
- CACNB1 (CACNB1 Products)
- Synonyms
- CACNB1 antibody, zgc:91982 antibody, CAB1 antibody, CACNLB1 antibody, CCHLB1 antibody, Cchb1 antibody, Cchlb1 antibody, calcium voltage-gated channel auxiliary subunit beta 1 antibody, calcium channel, voltage-dependent, beta 1 subunit antibody, calcium channel, voltage-dependent, beta 1 subunit S homeolog antibody, CACNB1 antibody, cacnb1 antibody, Cacnb1 antibody, cacnb1.S antibody
- Background
- The protein encoded by CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.
- Molecular Weight
- 66 kDa (MW of target protein)
-