P2RX6 antibody (N-Term)
-
- Target See all P2RX6 Antibodies
- P2RX6 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This P2RX6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- P2 RXL1 antibody was raised against the N terminal of P2 XL1
- Purification
- Affinity purified
- Immunogen
- P2 RXL1 antibody was raised using the N terminal of P2 XL1 corresponding to a region with amino acids NWRVGALQRLLQFGIVVYVVGWALLAKKGYQERDLEPQFSIITKLKGVSV
- Top Product
- Discover our top product P2RX6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
P2RXL1 Blocking Peptide, catalog no. 33R-6932, is also available for use as a blocking control in assays to test for specificity of this P2RXL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 XL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P2RX6 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6))
- Alternative Name
- P2RXL1 (P2RX6 Products)
- Synonyms
- P2RXL1 antibody, P2X6 antibody, P2XM antibody, P2rxl1 antibody, P2x6 antibody, P2xm antibody, Rnap2x6 antibody, purinergic receptor P2X 6 antibody, purinergic receptor P2X, ligand-gated ion channel, 6 antibody, P2X purinoceptor 6 antibody, P2RX6 antibody, P2rx6 antibody, LOC100051842 antibody, LOC100588488 antibody
- Background
- The protein encoded by this gene belongs to the family of P2X receptors, which are ATP-gated ion channels and mediate rapid and selective permeability to cations. This gene is predominantly expressed in skeletal muscle, and regulated by p53. The encoded protein is associated with VE-cadherin at the adherens junctions of human umbilical vein endothelial cells. Alternative splicing results in multiple transcript variants. A related pseudogene, which is also located on chromosome 22, has been identified.
- Molecular Weight
- 49 kDa (MW of target protein)
-