NUDT9 antibody
-
- Target See all NUDT9 Antibodies
- NUDT9 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 9 (NUDT9))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NUDT9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NUDT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHA
- Top Product
- Discover our top product NUDT9 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NUDT9 Blocking Peptide, catalog no. 33R-8679, is also available for use as a blocking control in assays to test for specificity of this NUDT9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUDT9 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 9 (NUDT9))
- Alternative Name
- NUDT9 (NUDT9 Products)
- Synonyms
- sb:cb392 antibody, wu:fj16b09 antibody, wu:fu33g07 antibody, zgc:63924 antibody, LOC100230616 antibody, NUDT10 antibody, 1190002C07Rik antibody, AI462474 antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 9 antibody, nudix hydrolase 9 antibody, nudt9 antibody, NUDT9 antibody, Nudt9 antibody
- Background
- Human ADP-ribose pyrophosphatase NUDT9 belongs to a superfamily of Nudix hydrolases that catabolize potentially toxic compounds in the cell. NUDT9 alpha protein is targeted highly specifically to mitochondria, whereas the predicted protein of the NUDT9 beta transcript, which is missing this sequence, exhibits no clear subcellular localization. Investigation of the physical and enzymatic properties of NUDT9 indicates that it is functional as a monomer, optimally active at near neutral pH, and that it requires divalent metal ions and an intact Nudix motif for enzymatic activity.
- Molecular Weight
- 39 kDa (MW of target protein)
-