SCN5A antibody (C-Term)

Catalog No. ABIN633685

Product Details anti-SCN5A Antibody

Target: SCN5A (Sodium Channel, Voltage-Gated, Type V, alpha Subunit (SCN5A))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCN5A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SCN5 A antibody was raised against the C terminal of SCN5

Purification: Affinity purified

Immunogen: SCN5 A antibody was raised using the C terminal of SCN5 corresponding to a region with amino acids FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCN5A Blocking Peptide, catalog no. 33R-3093, is also available for use as a blocking control in assays to test for specificity of this SCN5A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SCN5A

Target: SCN5A (Sodium Channel, Voltage-Gated, Type V, alpha Subunit (SCN5A))

Alternative Name: SCN5A (SCN5A Products)

Synonyms: Nav1.5 antibody, Nav1.5c antibody, SkM1 antibody, SkM2 antibody, mH1 antibody, CDCD2 antibody, CMD1E antibody, CMPD2 antibody, HB1 antibody, HB2 antibody, HBBD antibody, HH1 antibody, ICCD antibody, IVF antibody, LQT3 antibody, PFHB1 antibody, SSS1 antibody, VF1 antibody, SCAL antibody, sodium voltage-gated channel alpha subunit 5 antibody, sodium channel, voltage-gated, type V, alpha antibody, SCN5A antibody, Scn5a antibody

Background: SCN5A is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram.

Molecular Weight: 222 kDa (MW of target protein)