CACNA1I antibody (Middle Region)
-
- Target See all CACNA1I Antibodies
- CACNA1I (Calcium Channel, Voltage Dependent, T Type, alpha 1I Subunit (CACNA1I))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CACNA1I antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CACNA1 I antibody was raised against the middle region of CACNA1
- Purification
- Affinity purified
- Immunogen
- CACNA1 I antibody was raised using the middle region of CACNA1 corresponding to a region with amino acids LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS
- Top Product
- Discover our top product CACNA1I Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CACNA1I Blocking Peptide, catalog no. 33R-5397, is also available for use as a blocking control in assays to test for specificity of this CACNA1I antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACNA1I (Calcium Channel, Voltage Dependent, T Type, alpha 1I Subunit (CACNA1I))
- Alternative Name
- CACNA1I (CACNA1I Products)
- Synonyms
- CACNA1L antibody, Ca(V)3.3 antibody, Cav3.3 antibody, ca(v)3.3 antibody, si:ch211-51h13.1 antibody, Ca(v)3.3 antibody, calcium voltage-gated channel subunit alpha1 I antibody, voltage-dependent T-type calcium channel subunit alpha-1I antibody, calcium channel, voltage-dependent, alpha 1I subunit antibody, calcium channel, voltage-dependent, T type, alpha 1I subunit antibody, CACNA1I antibody, LOC100555412 antibody, Cacna1i antibody, cacna1i antibody
- Background
- Voltage-dependent calcium channels control the rapid entry of Ca(2+) into a variety of cell types and are therefore involved in both electrical and cellular signaling. T-type channels, such as CACNA1I, are activated by small membrane depolarizations and can generate burst firing and pacemaker activity.
- Molecular Weight
- 245 kDa (MW of target protein)
-